PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G063600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family S1Fa-like
Protein Properties Length: 92aa    MW: 10024.8 Da    PI: 10.1892
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G063600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA131.81.7e-412491370
                 S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                         v+ +eakG+nPGlivll+vggl+l+fl+gny+lyvyaqk+lPP+kkkP+skkk+kre+lk Gv++PGe
  Manes.03G063600.1.p 24 VKDIEAKGFNPGLIVLLLVGGLVLTFLIGNYALYVYAQKTLPPKKKKPISKKKMKRERLKHGVSAPGE 91
                         6789***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190137.0E-72491No hitNo description
PfamPF046898.6E-402791IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MDVEDGFEFA DHSPPSFQNV GNVVKDIEAK GFNPGLIVLL LVGGLVLTFL IGNYALYVYA  60
QKTLPPKKKK PISKKKMKRE RLKHGVSAPG E*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525167.13e-37PREDICTED: DNA-binding protein S1FA
SwissprotQ7XLX66e-16S1FA2_ORYSJ; DNA-binding protein S1FA2
TrEMBLB9SGP83e-37B9SGP8_RICCO; DNA-binding protein S1FA, putative
STRINGPOPTR_0016s08890.12e-30(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54093355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37120.14e-06S1FA-like DNA-binding protein